SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011398 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011398
Domain Number 1 Region: 12-134
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.2e-30
Family Class II glutamine amidotransferases 0.00016
Further Details:      
 
Domain Number 2 Region: 277-336
Classification Level Classification E-value
Superfamily PRTase-like 0.000000000000471
Family Phosphoribosyltransferases (PRTases) 0.0012
Further Details:      
 
Domain Number 3 Region: 410-511
Classification Level Classification E-value
Superfamily PRTase-like 0.000000000153
Family Phosphoribosyltransferases (PRTases) 0.00062
Further Details:      
 
Domain Number 4 Region: 228-294
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.0000012
Family Class II glutamine amidotransferases 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011398   Gene: ENSOPRG00000012489   Transcript: ENSOPRT00000012484
Sequence length 514
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3223:69063:95687:-1 gene:ENSOPRG00000012489 transcript:ENSOPRT00000012484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEESGIREECGVFGCIASGEWPTQLDVPHVITLLVGLQHRGQESAGIVTSDGSSVPTF
KTHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKSELENCQPFVVETLHGKIAVAH
NGELVNAARLRKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSETEGWVVSSESSFLSI
GARYYREVLPGEIVEISRHNVRTLDIIPTSESNPVAFCIFEYVYFARPDSMFENQMVYTV
RYRCGQQLAIEAPVDADLVSTVPESATPAALGYAAKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHIRVASPPI
RYPCFMGINIPTKEELIANKPEFDCLAEYLGANSVVYLSVEGLVSSVREKLKFQKQKVKK
HEVIQENGIGPENFERNGHCTACLTGQYPVELDW
Download sequence
Identical sequences ENSOPRP00000011398 ENSOPRP00000011398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]