SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011455 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011455
Domain Number 1 Region: 36-321,505-568
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.15e-88
Family FAD-linked reductases, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 328-509
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.14e-53
Family GMC oxidoreductases 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011455   Gene: ENSOPRG00000012553   Transcript: ENSOPRT00000012546
Sequence length 588
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3221:419653:424716:-1 gene:ENSOPRG00000012553 transcript:ENSOPRT00000012546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWVLQGWRLARQGLARAVGVGAPGWLQGRRALGTTEEFSYVVVGAGSAGCVLAARLSED
PAESVLLLEAGPKDVWAGSKRLSWKIHMPAALVANLCDDKYNWCYHTEPQPGLDGRVLYW
PRGRVWGGSSSLNAMVYVRGHAADYDRWQHQGAQGWDYAHCLPYFRKAQAHELGSDRYRG
GEGPLHVSRGKTNHPLHQAFLQAAQQAGYPFTEDMNGFQQEGFGWMDMTIHEGKRWSAAC
AYLHPTLSRPNLQAEARTLVRRVLFEGTRAVGVEYVSKGQSRVSKEVILSGGAINSPQLL
LLSGVGPADDLQKLGIPVVCHLPGVAQNLQDHLEIYIQQACTCITLHSAQKPLRKARIGL
QWLWKFSGDGATAHLETGGFIRSQPGIPHPDIQFHFLPSQVIDHGRVPTQQEAYQVHVGT
MRATSVGWLKLRSTNPEDHPVIQPNYLSTETDIKDFRLCVKLTREIFAQEALAPFRGEEL
QPGSHIQSDQEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDAS
IMPSVVSGNLNAPTIMIAEKAADIIRGRPALCDKDVPVYAPKTLAAQR
Download sequence
Identical sequences ENSOPRP00000011455 ENSOPRP00000011455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]