SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011456 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011456
Domain Number 1 Region: 237-589
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.89e-115
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000224
Further Details:      
 
Domain Number 2 Region: 86-229
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.23e-37
Family Anticodon-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011456   Gene: ENSOPRG00000012544   Transcript: ENSOPRT00000012547
Sequence length 612
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2207:87898:100925:-1 gene:ENSOPRG00000012544 transcript:ENSOPRT00000012547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRHTSGAEWGQRELRLCQLAPFTAHHKDKPLSDKNSELKRRLKAEKKLAEKEAKQKELSE
KQQNQAATAVSNHATDNGVGTEEESLDPNQYYKIRSQAVQQLKVNGEDPYPHKFHVDISL
THFIQEYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKS
EEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKET
RYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFIT
YHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEEIDLTHNSEFTTCEFYMAYA
DYHDLMEITEKAVSGMVKHVTGGYKVTYHPEGPEGQAYEIDFTPPFRRISMVEELEKALG
MKLPETHLFETEETRRILDDICVAKGVECPPPRTTARLLDKLVGEFLEVTCINPTFICDH
PQIMSPLAKWHRSKEGLTERFELFVMKKEVCNAYTELNDPMRQRQLFEEQAKAKAAGDDE
AMFIDENFCTALEYGLPPTAGWGMGIDRLTMFLTDSNNIKEVLLFPAMKPEDKKETVAAT
DTPESTTVGTSV
Download sequence
Identical sequences ENSOPRP00000011456 ENSOPRP00000011456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]