SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011488 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011488
Domain Number 1 Region: 348-467,517-756
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 1.7e-59
Family Tex N-terminal region-like 0.0078
Further Details:      
 
Domain Number 2 Region: 777-931
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.86e-24
Family Tex RuvX-like domain-like 0.0087
Further Details:      
 
Domain Number 3 Region: 946-1038
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000000667
Family Tex HhH-containing domain-like 0.0069
Further Details:      
 
Domain Number 4 Region: 1326-1417
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000249
Family SH2 domain 0.0033
Further Details:      
 
Domain Number 5 Region: 1227-1284
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000936
Family Cold shock DNA-binding domain-like 0.0099
Further Details:      
 
Domain Number 6 Region: 1051-1139
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000667
Family Tex HhH-containing domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011488   Gene: ENSOPRG00000012549   Transcript: ENSOPRT00000012580
Sequence length 1726
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_39:200359:228247:1 gene:ENSOPRG00000012549 transcript:ENSOPRT00000012580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDFVESEAEESEEEYNDDGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGNLKGFIND
DDDEEEGEEDEGSDSGDSEDDVGHKKRKRTSFDDRLEDDDFDLIEENLGVKVKRGQKYRR
VKKMSDDEDDDEEEYGKEEHEKEAIAEEIFQDGEGEEGQEAVEAPMAPPEEEEEDDEESD
IDDFIVDDDGQPLKKPKWRKKLPGYTDAALQEAQEIFGVDFDYDEFEKYNEYDEELEEEY
EYEDDEAEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESSHLTDQDNEIRATDLPERFQL
RSIPVKAAEDDELEEEADWIYRNAFATPTISLQESCDYLDRGQPTSSFSRKGPSTIQKIK
EALGFMRNQHFEVPFIAFYRKEYVEPELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKM
QAYQYEQISADPDKPLADGIRALDTTDMERLKDVQSMDELKDVYNHFLLYYGRDIPKMQN
AAKASRKKQKRVREEGDEEGEGEEAEDEEQRGPELKQASRRDMYTICQSAGLDGLAKKFG
LTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREP
LVRQVLRQTFQERAKLNITPTKKGRKDVDEAHYAYSFKYLKNKPVKELRDDQFLKIGLAE
DEGLLTIDISIDMKGVEGYGNDQTYFEEIKQFYYRDEFSHQVQEWNRQRTMAIERALQQF
LYVQMAKELKNKLLSEAKEYVIKACSRKLYNWLRVAPYRPDQQVEEDDDFMDENQGKGIR
VLGIAFSSARDHPVFCALVNGEGEVTDFLRLPHFTKRRTAWREEEREKKAQDIETLKKFL
LNKKPHVVTIAGENRDAQMLIEDVKRIVHELDQGQQLSSIGVELVDNELAILYMNSKKSE
AEFRDYPPVLRQAVSLARRIQDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEDLLSALYC
EFINRVNEVGVDVNRAIAHPYSQALIQYVCGLGPRKGTHLLKILKQNNTRLESRTQLVTM
CHMGPKVFMNCAGFLKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESA
EDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTA
YRSPNTEEIFNMLTKETPETFYIGKLIICSVTGIAHRRPQGESYDQAIRNDETGLWQCPF
CQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVG
MTVHCRIMKIDIEKFSADLTCRTSDLMDRNNEWKLPKDNYYDFDAEAADHKQEEDMKRKQ
QRTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQH
VDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPMASFARDLLNHKYYQDCRGRDR
KKLEELLIKTKEEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEYVTVTPEGFRYRGQI
FPTVNGLFRWFKDHYQDPVPGITPSSSSRTRTPASINATPANINLADLTRAVNALPQNMT
SQMFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGSSAYHVFPTPAQQPVATPLMTPS
YSYTTPSQPITTPQYHQLQASTTPQTAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQ
WLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR
Download sequence
Identical sequences ENSOPRP00000011488 ENSOPRP00000011488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]