SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Ochotona princeps 76 > ENSOPRP00000011522

Domain assignment for ENSOPRP00000011522 from Ochotona princeps 76

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSOPRP00000011522
Domain Number 1	Region: 208-246
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000000223
Family	EGF-type module	0.01
Further Details:

Domain Number 2	Region: 170-206
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000121
Family	EGF-type module	0.0097
Further Details:

Domain Number 3	Region: 87-132
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000655
Family	EGF-type module	0.017
Further Details:

Domain Number 4	Region: 129-173
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.000000335
Family	EGF-type module	0.014
Further Details:

Weak hits

Sequence:	ENSOPRP00000011522
Domain Number -	Region: 56-88
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00339
Family	EGF-type module	0.057
Further Details:

Domain Number -	Region: 34-55
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0106
Family	EGF-type module	0.057
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSOPRP00000011522 Gene: ENSOPRG00000012622 Transcript: ENSOPRT00000012615
Sequence length	381
Comment	pep:known_by_projection scaffold:pika:scaffold_3601:51249:56668:1 gene:ENSOPRG00000012622 transcript:ENSOPRT00000012615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MTATGVLLPVLLLLLAFGHSSSGTECFPACDPLNGVCEDHVCRCQPGWQGPLCDQCVTSP GCMNGFCEEPWQCLCQEGWDGKLCDTDVRACTSGPCANNSTCVNLDDGRYECSCSPGYLG QDCQQKAGPCVVNGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCEN DGVCTDIGGDFRCRCPAGFMDKTCSRPVTNCASQPCQNGGTCLQHTQVSYECLCQAEFTG PTCAKKRTPNPQQVTRLPSGQGLTYRLSPGVPELPASQPEHRTLKVSMKELNKSTPLLTE GQAICFTVLGVLTSLVVLGTVGIIFLNKCETWVSNLRYHHMLRKKKNLLLQYNSGEDLAV NIILPEKIDMATFSKEAGEEI
Download sequence
Identical sequences	ENSOPRP00000011522 ENSOPRP00000011522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]