SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011570 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011570
Domain Number 1 Region: 589-850
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.38e-91
Family Eukaryotic proteases 0.000000012
Further Details:      
 
Domain Number 2 Region: 340-444
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-22
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 3 Region: 226-331
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-20
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 4 Region: 449-485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 485-522
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 522-556
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 562-600
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000435
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011570   Gene: ENSOPRG00000012658   Transcript: ENSOPRT00000012669
Sequence length 851
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_547:53352:88180:1 gene:ENSOPRG00000012658 transcript:ENSOPRT00000012669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSDRARKGSGGPRDFGTGLKYSSRHEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXLTLLYSGFPSLGPYHKESAVTAFSEGSVIAYYWSKFSLPQHLVEDAERTMAEEHVVT
LPPRARSLSSFVMTSVVAFPTDRTXXXXXXXXXXXXXXARGGELTRFTTPGFPNSPYPAR
ARCQWTLRGDADMVLSLTFRSFDVASCDERGSDMVMVYNTLSPMEPHALVRLCGTYPPSY
NLTFLSSQNVLLVTLITSTERRHPGFEATFFQLPKMTSCGYLQGAEGTFSSPYYPGHYPN
MDCTWNIEVPSNRNVKVVFKVFLLLESNVPLGECPKDYVQINGEKYCGERAQFVVAGNSN
KLTVHFHSDQSYTDAGFLAEYVSYDSLDPCPGKFMCKTGRCIQKELRCDGWADCADHSDE
LNCKCNATHQFTCKNSFCKPRYWVCDTVNDCGDNSDELQCSCPAETFKCNNGKCLPQKQQ
CDGKDNCGDGSDEASCDSVSVVTCTAHTYRCQNGLCVNKGNECDGQNDCSDGSDEGNCDC
GLRSFSRQARVVGGTDADEGEWPWQVSLHVLGQGHVCGASLISPNWLVSAAHCYIDDKGF
KYSDPAQWIAFLGLHDQSKRSAAGVQEHRLKRIIVHPSFNDFTFDYDLALLELEKPAEYS
TTVRPICLPDTSHVFPAGKAIWVTGWGHTEEGGSGALILQKGEIRIINQTTCEDLMPQQI
TPRMMCVGFLSGGVDACQGDSGGPLSSVEADGRIFQAGVVSWGEGCAQRNKPGVYTRLSL
FRDWIKEQTGV
Download sequence
Identical sequences ENSOPRP00000011570 ENSOPRP00000011570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]