SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011798 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011798
Domain Number 1 Region: 21-141
Classification Level Classification E-value
Superfamily Lysozyme-like 3.44e-44
Family C-type lysozyme 0.00000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011798   Gene: ENSOPRG00000012936   Transcript: ENSOPRT00000012920
Sequence length 142
Comment pep:novel genescaffold:pika:GeneScaffold_3794:14175:17516:-1 gene:ENSOPRG00000012936 transcript:ENSOPRT00000012920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSLVLLLLVSSVFSAIQATQLTKCELSAKLKDLDGYGNIPMSEWICTLFHTSGLDTQIT
VNNNDSTEYGLFQISDKLWCKSKRNPRSRNICDIACEKFLDDDLIDDIMCAKKILDKEGI
DHWLAHKPLCSENLEQWVCKKL
Download sequence
Identical sequences ENSOPRP00000011798 ENSOPRP00000011798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]