SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011814 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011814
Domain Number 1 Region: 302-433
Classification Level Classification E-value
Superfamily SIS domain 0.00000000356
Family mono-SIS domain 0.0059
Further Details:      
 
Domain Number 2 Region: 28-279
Classification Level Classification E-value
Superfamily SIS domain 0.00000153
Family mono-SIS domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000011814
Domain Number - Region: 477-526
Classification Level Classification E-value
Superfamily SIS domain 0.00131
Family mono-SIS domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011814   Gene: ENSOPRG00000012928   Transcript: ENSOPRT00000012938
Sequence length 623
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1353:89382:113541:1 gene:ENSOPRG00000012928 transcript:ENSOPRT00000012938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHVIESPEPGEELSGYEASMPITEKSNPLTWDLDKANAEQIVQLLGQCDAEIF
QEEGQIVPPYQWLYSESILTTMVQVAGKIQEVLKEPDGGLVVLSRGGTSGRMAFLMLVSF
NQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISVG
LSAPFVAGQMDYCMDNTAVFLPGLVGFYPVSMARNDPIEDWSCTFRQIAERMQKMQEKQE
AFVLNPAVGPEGLSGSSRMKGGSATKVLLETLLLAAHKTVDRGIAPSQKCLLEILCTFEW
AHQVTYSSPKIASLMKQVSTSLKKKGRVHLVGWQTLGIIAIMDGVECIHTFGADFQDIRG
FLIGDHSDMFNQKAELTNQGPQFSFSQEDFQLCILPSITENDTVVFIFTLDDNLSEVEML
VQQVEEKTSSIQALAHGTVGQSLPLSLXXXXXXXXXXXXXXXXXXXXXXXXXKFQCELST
KWVLNTVSTGAHVLLGKILQNHMLEIRISNSKLFWRALTMLQRFSGQSKARCIESLLQAI
HFPQPLSDEIRAAPISRHIQVLHCKDQVIPVALLSLLFRCSTSEAQAHLAAATSICEAVR
SALTGPVRKRSGDLLQTPEPTTQ
Download sequence
Identical sequences ENSOPRP00000011814 ENSOPRP00000011814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]