SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011818 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011818
Domain Number 1 Region: 149-408
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.31e-57
Family Nuclear receptor ligand-binding domain 0.0000000071
Further Details:      
 
Domain Number 2 Region: 77-102
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000204
Family Nuclear receptor 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011818   Gene: ENSOPRG00000012948   Transcript: ENSOPRT00000012942
Sequence length 521
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_444:411462:564283:1 gene:ENSOPRG00000012948 transcript:ENSOPRT00000012942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKAFKACISGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRNDRNKKKKEPSKQECPESYEMTAELDEL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGXXXXXXXXXXXXXXXXXXXXXXXXXXXXRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNPAEHSPSISPSSMTAGSVSRHWYSRASSYFRHPPVPSVPGLKTQEQTFLLLLSFWTE
NILKLKKDQEVFICINIYPPHCVTEIQTATSKNQPFCAPRN
Download sequence
Identical sequences ENSOPRP00000011818 ENSOPRP00000011818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]