SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011833 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011833
Domain Number 1 Region: 133-448
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.34e-54
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000219
Further Details:      
 
Domain Number 2 Region: 452-589
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.1e-20
Family Ricin B-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011833   Gene: ENSOPRG00000012945   Transcript: ENSOPRT00000012958
Sequence length 596
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5141:691:153446:-1 gene:ENSOPRG00000012945 transcript:ENSOPRT00000012958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEARRIQTLSPVNILVFVGIVLFSVYCRFDRAHASIACGDQARSRLAGIVRANARNVLR
RLAHLGKVFYIWLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXCKQITYSEELPQVSVVFIFVNEALSVILRSVHSVVNHTPSQLLKEVI
LVDDNSDNAELKFNLDQYIQKRYPGLVKIVRNSRREGLIRARLQGWKVATAPVVGFFDAH
VEFNTGWAEPALSRIQEDRRRVILPAIDNIKFNTFEVQQYANAAHGYNWGLWCMYITPPQ
DWLDRADEAAPIRTPAMIGCSFVVDRQYFGDIGLLDPGMEVYGGENIELGMRVWQCGGSM
EVLPCSRVAHIERSRKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPVTNPGVDF
GDVSERLALRQRLKCRSFQWYLENVYPEMRVYSDTLAYGEVRNSKASGYCLDQGSEDDDQ
AILYPCHGMSSQLVRYSRDGLLQLGPLGSTAFLPDSKCLVDEGRGRSPALKKCENVARPT
QRLWDFIQGSPIVSRDTGRCLEVELSREANFGLRLVVQRCSGQKWTIRNWVMNPQP
Download sequence
Identical sequences ENSOPRP00000011833 ENSOPRP00000011833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]