SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011884 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011884
Domain Number 1 Region: 329-455
Classification Level Classification E-value
Superfamily GAD domain-like 4.74e-26
Family GAD domain 0.0014
Further Details:      
 
Domain Number 2 Region: 43-145
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.9e-24
Family Anticodon-binding domain 0.00045
Further Details:      
 
Domain Number 3 Region: 556-625
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.87e-17
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00023
Further Details:      
 
Domain Number 4 Region: 148-213
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00000000000332
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00092
Further Details:      
 
Domain Number 5 Region: 273-350
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.0000000383
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011884   Gene: ENSOPRG00000013012   Transcript: ENSOPRT00000013020
Sequence length 636
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1557:45620:72659:1 gene:ENSOPRG00000013012 transcript:ENSOPRT00000013020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSAAGLALLSRALCRPVGWASLHRSLTLSAGRRTPLSSFTARTNTCGELRSSHLGQDVT
VCGWIQHRRQNLFLVLRDSYGLVQVVIPQDESAASVKKVLCEAPVESVVRVSGTVIPRPP
GQENPKMPTGEIEIKVKTAEILNSCKKLPFEIKDFVKKTEARLRYRYLDLRSSQMQHNLR
LRSRMVMKMREYLCNMHGFVDIETPTLFKRTPGXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDIEMSFVEQAGIQRLVEGLLQYCWPRG
GAALAAPFPCMSYAEALATYGTDKPDTRFGMKIIDISSVFRSTEVRFLQDALNKPQGTVQ
AIRVPEGAKYLKRKDIESIRKLAADHFNQEVLPVFLKASTSWNSPVAQLIMEEQRLELMR
LMEVREEDVIFLTAGEHKKSCSVLGRLRLACADLLXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXEDVKLLSHLLQALEYGAPPHGGIALGLDRLTCLVTGAASIRDVIAFPKSF
RGHDLMSGAPDCVPAEELKPYHVQVSWPADSDRAQP
Download sequence
Identical sequences ENSOPRP00000011884 ENSOPRP00000011884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]