SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011899 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011899
Domain Number 1 Region: 571-601,640-718
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.53e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011899   Gene: ENSOPRG00000013046   Transcript: ENSOPRT00000013039
Sequence length 737
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5435:983:35405:1 gene:ENSOPRG00000013046 transcript:ENSOPRT00000013039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEDEEQHDLSPRDSAEGNDQLLSVVDPEPQEESSTDYKQFETSDHCRPYSRIHMEPQE
KSNTNFKQFVIRKLQKNCHCSRAKAKNLIFDFLPVLRWLPKYDIKKNLLGDFMSGLIVGI
LLVPQSIAYSLLAGQEPIFGLYTSFFASIIFLLEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTQISSVVTALVLLLILLVIAPLFYSLQK
CVLGVITIVNLRGALKFRDLPKMWRVSKMDTVIWFVTMLSSALLSTEIGLLIGVCFSMFC
VILRTQKPKASLLGLVKESETFESTSAYKNLQTKPGIKIFRFVAPLYYINKECFKSALYK
KTLNPVLVKAAEKKAAKRKLREGAVNLGSVQDEVSAHLSPDLQELHTVVIDCSAIQFLDT
AGIHTLKEVRRDYEAIGIQVLLAQCNPSVRDSLARGEYCKKEEENLLFYSVYEAVAFAEE
CQKQKATCIPNELSLDS
Download sequence
Identical sequences ENSOPRP00000011899 ENSOPRP00000011899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]