SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011909 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011909
Domain Number 1 Region: 89-135
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.000000000000119
Family Cysteine-rich DNA binding domain, (DM domain) 0.00037
Further Details:      
 
Domain Number 2 Region: 315-358
Classification Level Classification E-value
Superfamily UBA-like 0.000000638
Family CUE domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011909   Gene: ENSOPRG00000013060   Transcript: ENSOPRT00000013049
Sequence length 493
Comment pep:known_by_projection scaffold:pika:scaffold_5173:79784:84598:1 gene:ENSOPRG00000013060 transcript:ENSOPRT00000013049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQSRCGSRDRTASGRAHLAPGLVTAPAPVSETLPVVPGMPVPPTLLRPPSLFLRAATAA
AAAANQGSGGCLAAPGLERAVGAAGCGYPRMPKCARCRHGVVSALKGHKRFCRWRDCACA
KCTLIAERQRVMAAQVALRRQQTQEEKEARGLQRLLYPGPSGPEGHASGDSSRTQNAQAT
GRPTAVAALGLGVLRPLSGLATPSIEVFREDCSKDKKERKESICDSCQRQEQLSKSHQPS
LGSSQDVYGNQAISSSISEHSNKQDSILSSRLGDQSGGEESPASLSSSDLESGNESEWVK
DFAVTRTSLPTVSSRPRDPLDILTKIFPSYKRSWLEGILRFCKGDVVQAIEQVLNGKEHK
SDARGLVSTELESTLHHSAPNFSLAGICFGTLGTKSAFSPLQTTSASYQADSELYSLNPR
LGISPLRLAYSNPARGLSGFASPYLTPGLVPTLPYRPVLDYAFSGMVRDSSSISCKDSVT
AGRLYSQPNQDSL
Download sequence
Identical sequences ENSOPRP00000011909 ENSOPRP00000011909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]