SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011966 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011966
Domain Number 1 Region: 81-263
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.6e-42
Family Nuclear receptor ligand-binding domain 0.000000133
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000173
Family Nuclear receptor 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011966   Gene: ENSOPRG00000013120   Transcript: ENSOPRT00000013113
Sequence length 264
Comment pep:known_by_projection scaffold:pika:scaffold_19258:15472:21041:1 gene:ENSOPRG00000013120 transcript:ENSOPRT00000013113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFFRRTIRLKLAYDKCDRSCKILKKNRNKCQYCRFHKCLAVGMSHNAIRFGRMPRSEKAK
LKAEILTCEQEAEGPGSADLRSLARRIYEAYLKNFNMNKVKARVILAGKTSNNPXXXXXX
XXXXXXXXXXXXXXXXXXTGVQNKEAEVRIFHCCQCMSVETVTELTSSAKTIPGFASLDL
NDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAEGNGFITREFLKNLRKPFCDIMEPKFDFA
MKFNALELDDSDISLFVAAIICCG
Download sequence
Identical sequences ENSOPRP00000011966 ENSOPRP00000011966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]