SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011999 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011999
Domain Number 1 Region: 1528-1640
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-47
Family Noncollagenous (NC1) domain of collagen IV 0.000000516
Further Details:      
 
Domain Number 2 Region: 1416-1525
Classification Level Classification E-value
Superfamily C-type lectin-like 5.89e-45
Family Noncollagenous (NC1) domain of collagen IV 0.000000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011999   Gene: ENSOPRG00000013104   Transcript: ENSOPRT00000013148
Sequence length 1641
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4770:1099:93953:-1 gene:ENSOPRG00000013104 transcript:ENSOPRT00000013148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDCSGSGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGL
PGTKGTRGPPGAAGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFMGN
PGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGAPGLPGPPGLPGLQGPVGPPGFTGPPG
PPGPPGPPGEKGQMGLSFQGPKGDKDQGVSGPPGMPGHAQVQEKDFATKGKKGQKGEPGF
QGMPGIGEKGEPGRPGPRGKPGKDGEKGEKGSLGFPGDSGYPGLPGRVGPQGDKGEAGPP
GLPGIVIGTGPSGEKGERGFPGTPGLRGEPGPKGFPGIQGQPGPPGFAVPGQAGAPGFPG
ERGEKGDQGFPGTSLPGPSGRDGTPGPPGPPGPPGQPGHTNGIVECQPGPPGDQGPPGVP
GQPGLTGEVGEKGQKGDSCLVCDTEGLRGPPGPQGPPGEIGFPGQPGAKGDRGFPGRDGL
GGLPGPQGVPGLMGQPGAKGEPGEIYFDARLKGDKGDPGFPGQPGMPGRAGSPGRDGHPG
LPGPKGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXPLPGPPGAEGLPGSPGFQGPQGDRGFPGAPGRPGLPGEKGAMGQPG
IGFPGPPGPKGVDGQPGDRGLPGSPGRPGFNGLPGSPGLPGQKGEPGIGLPGLKGLPGLP
GIPGTPGEKGSIGGPGVPGEHGAIGPPGLQGIRGDPGPPGVQGPVGPPGAPGVGPPGAMG
PPGGQGPPGSAGPPGVKGEKGFPGFPGLDMPGPKGDKGAQGLPGLTGQSGMPGLPGQQGT
PGIPGFPGPKGEMGVMGTPGQPGSPGPVGIPGLPGEKGDQGFPGSSGPRGDPGFKGDKGD
VGLPGKPGSMDKVDMGSMKGQKGDQGEKGRQTGPTGDKGSRGDPGTPGVPGKDGQVGQPG
QPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGTPGEKGVPGIPGPQGMPGLPGEKGAKG
EKGQAGLPGIGIPRPGEKGDPGVAGFPGSPGEKGEKGSTGIPGMPGSPGPKGSPGSVGYP
GSPGLPGEKGDKGLPGLAGVPGIKGEAGVPGQPGPVGPAGQKGEPGSDGIPGSAGEKGEP
GLPGRGLQGFPGSKGDKGSKGDVGFPGLAGSPGIPGPKGEPGFMGPPGPQGQPGLPGAPG
RPMEGPKGDRGPQGQPGLPGLPGPMGPPGLPGLDGLKGDKGSPGWPGVPGLPGPKGDQGF
QGMPGIGGSPGVTGSKGDMGPPGVPGFQGQKGLPGLQGIKGDQGDQGVPGPKGLPGPPGP
PGPYDIIKGEPGLPGPEGPPGLKGLQGPPGPKGQQGVTGSVGTPGPPGIPGFDGAPGQKG
EQGPFGPPGPRGFPGPPGPDGLPGSMGPPGTPSVDHGFLVTRHSQTIDDPQCPPGTKILY
HGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEP
MPMSMAPITGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPNGWSSLWIGYSFVMHTS
AGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPS
TLKAGELRTHVSRCQVCMRRT
Download sequence
Identical sequences ENSOPRP00000011999 ENSOPRP00000011999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]