SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012027 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012027
Domain Number 1 Region: 63-308,416-478
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.19e-41
Family FAD-linked reductases, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012027   Gene: ENSOPRG00000013177   Transcript: ENSOPRT00000013177
Sequence length 486
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3679:63719:69532:1 gene:ENSOPRG00000013177 transcript:ENSOPRT00000013177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRVLQLGLGRGPGNRRLGTRRGGSALDWDEKLSEFKKKIRSALPGEACNVLYNTSHLP
PEHADVVIVGGGVLGLSVAFWLKKLEKPQGAIRVLVVERDHTYSRASTGLSVGGIRQQFS
LPENVQLSLFSINFLRNINDYLAVVDAPPLDLQFNPSGYLLLASETGASTLENNVKVQRQ
EGAKICLMSPEQLRNKFPWINTEGVALASYGMEDEGWFDPWSLLQGLRRKAQSMGVLFCQ
GEVTRFVSSSNRMETTSGEEMILKRIHEVHVKMEHSPEYQPVECAIVINAAGAWSGEIAE
LAGIGKGPPGTLQGTKLPVEPRKRYVYLWHCPQGPGLETPLVADTNGVYFRREGLGHNYL
GGRSPSEEEEPDPGNLEVDHDFFQDRVWPHLAQRVPTFENLKVRSAWAGYYDYNTFDQNG
VVGPHPLVVNMYFATGFSGHGLQHAPAVGRAVAEMVLEGHFQTIDLSPFLFTRFHLGEKV
LEQNIF
Download sequence
Identical sequences ENSOPRP00000012027 ENSOPRP00000012027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]