SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012047 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012047
Domain Number 1 Region: 1484-1590
Classification Level Classification E-value
Superfamily C-type lectin-like 2.59e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000082
Further Details:      
 
Domain Number 2 Region: 1589-1620
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000137
Family Noncollagenous (NC1) domain of collagen IV 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012047   Gene: ENSOPRG00000013170   Transcript: ENSOPRT00000013199
Sequence length 1620
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4770:143167:250475:1 gene:ENSOPRG00000013170 transcript:ENSOPRT00000013199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARERLAAPGPALQWWLLLGTVTMGLLWQSALANKKLDVPCGGRDCSGGCQCYPEKGGRG
QPGPVGPGYTGPPGLQGFAGLQGRKGDKGERGAPGITGPKGDVGARGVSGFPGADGIPXX
XXXXGPRGRPGYDGCNGTKGRGLQGPPGDGFPGSPGPQGPKGQKGEPYTLPEEERGRYRG
ETGEPGLVGIQGPPGRPGPMGPMGPVGAAGQPGPLSSLENXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARGDPG
FPGAHGEPGSRGEPGDPGPPGPPGRPARGEDEMRGLPGEMGPKGFIGEPGIPASFSDPPG
ADGRPGLPGAPGSSGPPWTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAGDCKCLE
GDQYVGGLPGLPGPKGLPGFNGEPGRKGDQGDPGQHGIPGFPGLKGTPGLPGVPGPKGAK
GDSRTVSTKGERGQPGVPGVPGMKGDDGVPGHDGLDGFPGLPGPPXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXCVAGPKGLPGPPGPPGPAGAKGLQGTPGFSGADGPPGLKGLPGDPGR
EGYPGPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXLPGERGDPGDTGVPGPVGMKGLAGDRGDAGYSGERGQPGSPGFK
GMVGMPGIPGPKGERGSPGMDGFQGMLGLKGRPGLPGIKGETGFFGRTGEKGPAGEPGDK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPMGLKGYLGLKGIQGMPGVPGLAGIPGLPG
RPGHIKGVKGDIGVPGVPGLPGFPGVAGPPGIIGFPGFTGSRGDKGAPGRAGLYGEVGQT
GDLGDVGDTIDLPGSPGLKGEQGTAGVPGVKGFFGEKGAEGEVGFPGITGLTGAQGPPGL
KGQTGFPGLTGLQGPQGDPGQIGRPGDKGDQGWPGRPGLPGFPGLRGIGGLHGLPGTKGL
QGSPGADIHGDPGFPGPTGDRGDPGEPNTLPGPVGVPGHKGEQGVPGERGPAGSPGLQGF
PGITPPSNISGLPGDKGAAGIFGPQGYPGLPGPPGPAALPGSKGEDGSPGTAGIPGSKGW
VGXXXXXXXXXXXXXXXXXXPRGEQGFMGNTGATGAAGDRGPKGPKGDQGFPGAPGPVGS
PGIVGLPQRVAVQHGPVGPQGRRGPPGAQGEMGPQGPPGEPGLRGAPGKAGPQGRGGVSA
VPGIRGDQGPMGHPGPVGQEGEPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQEPMCPTG
MNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDICYYASRNDKSYWL
STTAPLPMMPVAEEEIRPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLWIGYSFLM
Download sequence
Identical sequences ENSOPRP00000012047 ENSOPRP00000012047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]