SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012085 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012085
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-43
Family Galectin (animal S-lectin) 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012085   Gene: ENSOPRG00000013253   Transcript: ENSOPRT00000013242
Sequence length 132
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_714:148466:151549:-1 gene:ENSOPRG00000013253 transcript:ENSOPRT00000013242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKFEMTNLDLKEGASLKLKGKIHESSDGFIINLGQEADTLCMHFNPRFKESTIVCNSK
DGGKWGKEQRESHLGFGPGSEVKFTVTFEGDKFKVKLPDGHEVMFPNRLGHSQLNYLAVH
GGLRVSSIKFEK
Download sequence
Identical sequences ENSOPRP00000012085 ENSOPRP00000012085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]