SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012148 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012148
Domain Number 1 Region: 739-838,879-983
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.01e-39
Family Nuclear receptor ligand-binding domain 0.000000573
Further Details:      
 
Domain Number 2 Region: 600-682
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-24
Family Nuclear receptor 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012148   Gene: ENSOPRG00000013315   Transcript: ENSOPRT00000013310
Sequence length 985
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_372:447134:771358:-1 gene:ENSOPRG00000013315 transcript:ENSOPRT00000013310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKGCHSLPEGLDMEKRWSQMSQTVQRSTLASAERNDENNCMEVVNASCVPGAIPNNST
QGSNKEKHELLPCLQQDSSRAGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYD
PQNPQGSGSPAKMYQNVEQLVKFYKENGHRPSTLSSLGRPLRSLMSDCGSSVNGGVMRAL
VKSPSLCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPN
VESRGSRSHSPAHASNVGSPLSSSLSSMKSPISSPPSHCSVKSPVSSPNNITLRSSVSSP
ANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVSNAFSYTAPGSSAGSSASRDMIP
SPDTHEKGAQEVAFPKTEEVDSAISNGVTGQLNLVQYIKPEPDGAFGSSCLAGNSKINSD
SPFSVPIKQESTKHSCSGTSFKGSPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DGSCEGSGFPVGIKQEPDDGSYYPEASIPPSAIVGVNSGGQSFHYRIGAQGTISLSRSAR
DQSFQHLSSFPPVNTLVEPWKSHGDLPSRRSDAYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGNCPWQHNYLCAGRNDCIIDKIRRKNCP
ACRLQKCLQAGMNLGARKSKKLGKLKGLHEEQPQQPPPPPPPQSPEEGTTYIAPAKEPSV
NTALVPQLSTITRALTPSPVMILENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQ
VVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKDGLKSQSAFEEMRANY
IKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESQALKVEFPAM
LVEIISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences ENSOPRP00000012148 ENSOPRP00000012148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]