SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012278 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012278
Domain Number 1 Region: 182-239
Classification Level Classification E-value
Superfamily C-type lectin-like 1.7e-17
Family C-type lectin domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012278   Gene: ENSOPRG00000013455   Transcript: ENSOPRT00000013453
Sequence length 248
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_696:18870:26554:1 gene:ENSOPRG00000013455 transcript:ENSOPRT00000013453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQTRDEEEDDDYENSAPPYKDLPPKPIPLSPTGSFAPPRPPRIAQEAERLPLPCKRSQLT
GLDLSPAPCLSPELGVQLELSSSHPPTATPAVSWLSLKHGAPACCPEKRLVLSVCLLAAL
SLLLSCAGLTVSLIQYHNIADKLRSLTLEQLAWQANVTGVAGLAGLRNDVDRVRADTNRS
LVELQGLLDCTRVTCPEGWLPFEGKCYYFSPNTKTWDGALVFCQENFAHLVIINSKAEQL
LGPRRAQQ
Download sequence
Identical sequences ENSOPRP00000012278 ENSOPRP00000012278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]