SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012303 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012303
Domain Number 1 Region: 359-414
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000157
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 2 Region: 308-354
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000085
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000012303
Domain Number - Region: 962-1103,1140-1188
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000211
Family Rhodopsin-like 0.043
Further Details:      
 
Domain Number - Region: 532-574
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00497
Family Hormone receptor domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012303   Gene: ENSOPRG00000013440   Transcript: ENSOPRT00000013479
Sequence length 1565
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2606:150604:178196:-1 gene:ENSOPRG00000013440 transcript:ENSOPRT00000013479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGNTGGEGKGHRMTPACPLLLSVILSLRLAAAFDPAPSACSAASGVLYGAFSLQDLFPTI
ASGCSWTLENPDPTKYSLYLRFNRQEQVCTHFAPRLLPLDHYLVNFTCLRSSSEQAVAQE
ESEVGRPEEEAVAAAAGLELCGGSGPFTFLHFDKNFVQLCLSAEPSEAPRLLAPAALAFR
FVEVLLINNNNSSQFTCGVLCRWSEECGRAAGRACGFAQPGCSCPGEAGVGSTTTTLPGP
PATYTLSNALVPGGPAPPAEADLHSGSSNDLFTTEMRYGEEPEEEPKVKTQWPRSADEPG
LYMAQTGDPAAEEWSPWSVCSLTCGQGLQVRTRSCVSSPYGTLCSGPLRETPCNNCATCP
VHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAACPXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRCPAFHEMCRDEYVMLM
TWKKAAAGEIIYNKCPPNASGSASRRCLLSAQGVAYWGLPSFARCISHEYRYLYLSLREH
LAKGQRMLAGEGMSQVVRSLQELLARRTYYSGDLLFSVDILRNVTDTFKRATYVPSADDV
QRFFQVVSFMVDAENKYKWDDAQQVSPGSVHLLRVVEDFIHLVGDALKAFQSSLIVTDNL
VISIQREPISAVSSDITFPMRGRRGMKDWVRHSEDRLFLPKEVLSLSSPGKPATSGAAGS
PGRGRGPGTVPPGPGHSHQRLLPADPDESSYFVIGAVLYRTIGLILPPPRPPLAVTSRVM
TVTVRPPTQPPAEPLINGTTDPHCASWDYSRADASSGDWDTESCQTLETQAAHTRCQCQH
LSTFAVLAQPPKDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIKSERSIILL
NFCLSILASNILILVGQSRVLSKGVCTMTAAFLHFFFLSSFCWVLTEAWQSYLAVIGRMR
TRLVRKRFLCLGWGLPALVVAVSVGFTRTKGYGTSSYCWLSLEGGLLYAFVGPAAVIVLV
NMLIGIIVFNKLMARDGISDKSKKQRAGSERCPWAGLLLPCSACGVVPSPLLSSASARNA
MASLWSSCVVLPLLALTWMSAVLAMTDRRSVLFQALFAVFNSAQGFVITAVHCFLRREVQ
DVVKCQMGACRADESEDSPDSCKNGQLQILSDFEKDVDLACQTVLFKEVNTCNPSTITGT
LSRLSLDEDEEPKSCLVGPEGGLSFSPLPGNILMPMAASPGLGEPPPPQETNPVYMCGEG
GLRPLDLTWLRPADPGSEGDYMVLPRRTLSLQPGGGSGGGGGGGGEDAPRTRPEGTPRRA
AKTVAHTEGYPSFLSVDHSGLGLGPAYGSLQNPYGMSFQPPPTPSARQVPEPGERSRTMP
RTVPGSTMKLGSLERKKLRYSDLDFEKVMHTRKRHSELYHELNQKFHTFDRYRSQSSAKW
SLSLEKPSPGEHPGLAPQRRHQSWSTFKSMTLGSLPPKPRERLALHRAAAWEPTEPPDGD
FQTEV
Download sequence
Identical sequences ENSOPRP00000012303 ENSOPRP00000012303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]