SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012412 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012412
Domain Number 1 Region: 787-941
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-72
Family Thrombospondin C-terminal domain 0.00000166
Further Details:      
 
Domain Number 2 Region: 515-598
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.75e-19
Family TSP type-3 repeat 0.0000667
Further Details:      
 
Domain Number 3 Region: 225-270
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000109
Family Assembly domain of cartilage oligomeric matrix protein 0.002
Further Details:      
 
Domain Number 4 Region: 596-641
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000131
Family TSP type-3 repeat 0.001
Further Details:      
 
Domain Number 5 Region: 316-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000168
Family EGF-type module 0.02
Further Details:      
 
Domain Number 6 Region: 53-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000475
Family Laminin G-like module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000012412
Domain Number - Region: 363-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 278-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0778
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012412   Gene: ENSOPRG00000013573   Transcript: ENSOPRT00000013603
Sequence length 958
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3895:244:10242:-1 gene:ENSOPRG00000013573 transcript:ENSOPRT00000013603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQELRGALALLLLCSLAFASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQASLADG
RTHTAILRLRGPSRPSPGLQLYVDCRLGDQHAGLPALAPIPPAEVSGLEIRTGQKAYLRM
QGFVESMKLILGGSMARVGALSECPFQGDDSIHNAVASALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECAHADPCFPGSKCINTMPGFHCEACPRGYKGTRVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFTSGPCRLSILTNQWHGCLPARTCQS
PAHSTCHVCLHLFERNGAVSCHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNCRLFPNKDQQNSDTDSFGDACDN
CPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDSC
PEMSNPTQTDVDSDLVGDVCDTNEDSKEDGHHDASDKCQVLKQCTAXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSA
SGPGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGP
QLVADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRA
Download sequence
Identical sequences ENSOPRP00000012412 ENSOPRP00000012412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]