SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012477 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012477
Domain Number 1 Region: 49-236
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.33e-49
Family Proteasome subunits 0.00000000741
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012477   Gene: ENSOPRG00000013677   Transcript: ENSOPRT00000013675
Sequence length 261
Comment pep:novel genescaffold:pika:GeneScaffold_1876:132434:143188:-1 gene:ENSOPRG00000013677 transcript:ENSOPRT00000013675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRNQYDNDVTVWPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAQSDFAAHQKK
ILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQR
YGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMEC
NLNELVKHGLHALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQR
KAQPAQPTDEPAEKADEPMEH
Download sequence
Identical sequences ENSOPRP00000012477 ENSOPRP00000012477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]