SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012563 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012563
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.19e-16
Family Proteasome subunits 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012563   Gene: ENSOPRG00000013782   Transcript: ENSOPRT00000013771
Sequence length 191
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5500:996:4304:1 gene:ENSOPRG00000013782 transcript:ENSOPRT00000013771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPF
GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAERE
KKEKEQKEKDK
Download sequence
Identical sequences ENSOPRP00000012563 ENSOPRP00000012563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]