SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012575 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012575
Domain Number 1 Region: 190-416
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.6e-65
Family Nuclear receptor ligand-binding domain 0.0000000201
Further Details:      
 
Domain Number 2 Region: 84-158
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-26
Family Nuclear receptor 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012575   Gene: ENSOPRG00000013780   Transcript: ENSOPRT00000013783
Sequence length 459
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_763:4921:60635:1 gene:ENSOPRG00000013780 transcript:ENSOPRT00000013783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEDRHLGSSCGSFIKTEPSSPSSGMDALSHHSPSGSSDASGSFGLALGAHANGLDSPS
MFAGALIMEDSAIKCEYMLNTIPKRMCLVCGDIASGFHYGVASCEACKAFFKRTIQGNIE
YSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXTKIVSCLMVAEPNNLQAMPPAGIPEADIKALATLCDLADRELVVIIG
WAKNIPGFSELSLGDQMSLLQSAWMEILILGVVYRSLPYDDKLVYAEDYIMDEEHSRLTG
LIELYQAILQLVRRYKKLKVVKEEFVTLKALALANSDSMYIEDLEAVQKLQDLLHEALQD
YELSHRHEEPRRTGKLLLTLPLLRQTATKAVQYFYSIKMQGKVPMHKLFLEMLEAKVGRT
LWEGSWGGGASCKGKYLFSQCSSQTIPGGKACRLRVTVH
Download sequence
Identical sequences ENSOPRP00000012575 ENSOPRP00000012575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]