SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012602 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012602
Domain Number 1 Region: 12-226
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.05e-60
Family Proteasome subunits 0.000000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012602   Gene: ENSOPRG00000013823   Transcript: ENSOPRT00000013814
Sequence length 272
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2209:553319:555356:-1 gene:ENSOPRG00000013823 transcript:ENSOPRT00000013814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRPALEVRGGFSFENCQRNTALGRLLPDFRVPHARKTGTTIAGLVFRDGVILGADTRAT
NDSVVADKSCQKIHFIAPNIYCCGAGVAADTEMTTRMAASNMELHALATGREPRVATVTR
LLRQTLFRYRGHVGASLIVGGVDLNGPQLYGIHPHGSFSRLPFTALGSGQDAAMAMLEDR
FQPNMTLEAAQSLLVEAITAGILGDLGSGGSVDACVITETGAKMLWTLSSPTKPLEKSHY
QFAPGTTAVLTQTVQPLDLELLEETVQTMEVE
Download sequence
Identical sequences ENSOPRP00000012602 ENSOPRP00000012602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]