SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012718 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012718
Domain Number 1 Region: 31-86
Classification Level Classification E-value
Superfamily Kringle-like 1.77e-16
Family Fibronectin type II module 0.0044
Further Details:      
 
Domain Number 2 Region: 1-42
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000799
Family Fibronectin type II module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012718   Gene: ENSOPRG00000013952   Transcript: ENSOPRT00000013937
Sequence length 86
Comment pep:novel genescaffold:pika:GeneScaffold_5396:815:1191:1 gene:ENSOPRG00000013952 transcript:ENSOPRT00000013937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVFSFRYRGQVFHDCTQLNARHKWCSLNQSYTGYWKYCTAADFAKCVFPFWFRRMIYWEC
TDDGNDFGKKWCSLTQDFNRDQIWKF
Download sequence
Identical sequences ENSOPRP00000012718 ENSOPRP00000012718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]