SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012833 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012833
Domain Number 1 Region: 223-288
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.03e-16
Family Complement control module/SCR domain 0.00057
Further Details:      
 
Domain Number 2 Region: 162-232
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000162
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 3 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000445
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 36-105
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000769
Family Complement control module/SCR domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012833   Gene: ENSOPRG00000014064   Transcript: ENSOPRT00000014063
Sequence length 354
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1446:40656:67957:1 gene:ENSOPRG00000014064 transcript:ENSOPRT00000014063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEPSVRRQSPLPNRWRILGTLLVTVGFLLFTCSDACGPPPTFEAMELIGKPKPFYKPGEY
ANYRCKVGWEYVYLFTTSTYCEQNNSWLPITDWACEKIKCAQLPIIPHCREHIVNGTLAW
GHQVHFECDEGYISRRKFVTCLLKGSTTHWSHGVPRCEKILCSPPPKIKNGKHTFSDVEI
FEYSESVTYSCDPSHKEDEFSLVGEKSLYCVANGVWSSGAPECRVVRCPFPELKNGRQVT
GFRKKYYYQAMIMFECNVGYHLQGSETVTCNSNSTWEPPVPTCVKVVTTPTIKPPLSTIS
VVTTPSMKLAHSTVGPRPTHPTKPPVYNYPGYPEAGIVACGTCLYKCCQSRKKK
Download sequence
Identical sequences ENSOPRP00000012833 ENSOPRP00000012833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]