SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012851 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012851
Domain Number 1 Region: 4-126
Classification Level Classification E-value
Superfamily Histone-fold 7.04e-48
Family Nucleosome core histones 0.0000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012851   Gene: ENSOPRG00000014094   Transcript: ENSOPRT00000014083
Sequence length 130
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1253:132344:132736:-1 gene:ENSOPRG00000014094 transcript:ENSOPRT00000014083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKAK
Download sequence
Identical sequences ENSOPRP00000012851 ENSOPRP00000012851 XP_012786154.1.84141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]