SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012917 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012917
Domain Number 1 Region: 3-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.79e-96
Family Carbonic anhydrase 0.000000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012917   Gene: ENSOPRG00000014161   Transcript: ENSOPRT00000014155
Sequence length 260
Comment pep:known_by_projection scaffold:pika:scaffold_3435:50430:59828:1 gene:ENSOPRG00000014161 transcript:ENSOPRT00000014155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKDWGYANHNGPDHWHEFFPNAKGDNQSPIELHTKDIRHDPTLLPWSASYDPGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLSGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTYGEALRQPDGIAVVGVFLKIGREKGPFQIFLDALDKIKTKGKEAPFTHFDP
SCLFPACRDYWTYRGSFTTPPCEECIVWLLLKEPVTVSSDQIAKLRTLLSSAENEPPVPL
VRNWRPPQPIKGRVVRASFK
Download sequence
Identical sequences ENSOPRP00000012917 ENSOPRP00000012917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]