SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012941 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012941
Domain Number 1 Region: 475-636
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.81e-48
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 258-374
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000275
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 3 Region: 417-448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000589
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 166-251
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000106
Family Spermadhesin, CUB domain 0.006
Further Details:      
 
Domain Number 5 Region: 382-415
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000223
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000012941
Domain Number - Region: 8-43
Classification Level Classification E-value
Superfamily SEA domain 0.00183
Family SEA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012941   Gene: ENSOPRG00000014172   Transcript: ENSOPRT00000014179
Sequence length 636
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1856:71009:114547:-1 gene:ENSOPRG00000014172 transcript:ENSOPRT00000014179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKADVTVSQVYAGSLRVLNRHFSQDLARRESSAFRSETAKAQNVXXXXXXXXXXXXXXXX
XXXXXXXEGPLTCFFWFILQIPEHRQPMLSPEVVQALLAQELLSAANDSAPAPYRTEYEV
DPQGLVILEASVKDIVALNSTLXXXXXXXXXXXXXXXLKGPDHLASSCLWHLQGPADLML
KLRLEWTRADCRDRLAMYDVAGPLERRLITSVYGCSRQEPVVEVLASGAVMSVVWKKGLH
SYYDPFMLSVQPVAFQDCQVNLTLEGRLDLQGVLSTPYFPSYYSPSTHCSWHLTVPSLDY
GLALWFDAYALRRQKYDLPCTQGQWMIQNRRLCGLRTLQPYAERIPVLAMAGVTINFTSQ
ISLTGPGVQVHYSLYNQSDPCPGEFLCSVNGLCVPACDGIKDCPNGLDERNCVCRATFQC
REDSTCISPSRVCDRQPDCLNGSDEEQCQEEVPCGTFTFQCEDRSCVKRPNPQCDGWPDC
ADGSDERHCDCGLQGPSGRIVGGAVSSEGEWPWQASLQVRGRHICGGALIADRWVITAAH
CFQEDSMASPALWTVFLGKVWQNSRWPGEVSFKVSRLLLHPYHEEDSHDYDVALLQLDHP
VVRSATVRPICLPARSHVFESGLHCWITGWGALREG
Download sequence
Identical sequences ENSOPRP00000012941 ENSOPRP00000012941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]