SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013002 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013002
Domain Number 1 Region: 70-208
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-40
Family C-type lectin domain 0.0000903
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013002   Gene: ENSOPRG00000014243   Transcript: ENSOPRT00000014243
Sequence length 218
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3755:37975:42959:-1 gene:ENSOPRG00000014243 transcript:ENSOPRT00000014243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSTLSVSQCTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTYRIFQTCDGTRSQLD
DGITELSCYNDGLGSVKSCCPLNWKYFQFSCYFFSTDTLPWTASLKSCANVGAHLVIIDT
LEEQEFLFHTKPPKKEFYIGLTDQVVEGQWKWVDGTPLAQSLSFWDVGEPNNIVTLEDCA
TIRDSTNPKKNWNDVSCFFNMFRICEMPEINNLSKANL
Download sequence
Identical sequences ENSOPRP00000013002 ENSOPRP00000013002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]