SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013039 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013039
Domain Number 1 Region: 140-388
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-69
Family Nuclear receptor ligand-binding domain 0.00000000145
Further Details:      
 
Domain Number 2 Region: 71-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013039   Gene: ENSOPRG00000014280   Transcript: ENSOPRT00000014282
Sequence length 488
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1701:132209:152993:1 gene:ENSOPRG00000014280 transcript:ENSOPRT00000014282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMADYSAALDPAYTTLEFENVQVLAMGNVWPPMSLLCHDWGGSGRVSPPQGDTSPSEGT
NLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDK
DKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQIT
SPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGE
HLLLGATKRSMVLKDVLLLGNDYIVPRHCPELAEMSRVSMRILDELVLPFQELQIDDNEY
ACLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQS
ITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSSSDAPHAHHPLHPHLMQEHMGTNVIVAN
TMPTHLSNGQMCEWPRPRGQAATPETPQPSPPGGSGSEPYKLLPGAITTIVKPPSAIPQP
TITKQEVI
Download sequence
Identical sequences ENSOPRP00000013039 ENSOPRP00000013039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]