SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013047 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013047
Domain Number 1 Region: 337-398
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.02e-20
Family Complement control module/SCR domain 0.0048
Further Details:      
 
Domain Number 2 Region: 279-337
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000292
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 97-152
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000135
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 4 Region: 2-58
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000813
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 5 Region: 60-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000027
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013047   Gene: ENSOPRG00000014291   Transcript: ENSOPRT00000014290
Sequence length 399
Comment pep:novel genescaffold:pika:GeneScaffold_2630:2083:24146:1 gene:ENSOPRG00000014291 transcript:ENSOPRT00000014290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IECPLPFLEAYLDAHPKQEKYKVGDVLKFSCRQKFARVGPDSVQCYQFGWSPNFPTCKDG
EVVQYECNSHFAVKGPKKIQCMDGEWTTLPTCVGPLQTCSSLPKLEHGYAQPSAPPYPHG
ATVELSCRSTHTMIGNHSVSCLSGMWTELPECVXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATQSCGPPPPIDNGDITSFPLLKYPP
GSRVGYSCQAFYELKGHGYVTCRNGRWSESPKCLDACIISEENMNKNNIQLKWRDSRKLY
AKTGDIVEFMCKDSYKAARHTSAFRAVCHEGKFEYPKCE
Download sequence
Identical sequences ENSOPRP00000013047 ENSOPRP00000013047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]