SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013079 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013079
Domain Number 1 Region: 29-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.74e-38
Family Laminin G-like module 0.00000000769
Further Details:      
 
Domain Number 2 Region: 1085-1166
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-34
Family Thrombospondin C-terminal domain 0.00000761
Further Details:      
 
Domain Number 3 Region: 489-541
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.31e-17
Family TSP-1 type 1 repeat 0.0000256
Further Details:      
 
Domain Number 4 Region: 433-482
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 4.84e-16
Family TSP-1 type 1 repeat 0.000036
Further Details:      
 
Domain Number 5 Region: 315-372
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000282
Family VWC domain 0.0079
Further Details:      
 
Domain Number 6 Region: 689-776
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000131
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 7 Region: 377-426
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000327
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 8 Region: 545-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000275
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000013079
Domain Number - Region: 806-840
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00222
Family TSP type-3 repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013079   Gene: ENSOPRG00000014313   Transcript: ENSOPRT00000014329
Sequence length 1167
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2366:208791:238902:1 gene:ENSOPRG00000014313 transcript:ENSOPRT00000014329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLAWGLGVLFLLQACGTNRIPESGGDNSVFDIFELTGAARRGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRADKGFLFLASLRQLKKTRGTLLALERKDNSGQIFSVV
SNGKAGTLDLSLTVQGKQHVVSVEDALLATGHWKSITLFVQEDRAQLYIDCEKMENAELD
VRIQSIFTRDLANVARLRVAKGGVNDNFQGALQNVRFVFGTTPEDILRNKGCSSNSGVLL
PFDNNVVNGSSPAIRTDYVGHKTKDAICGISCEELSNIFLELRGLRTIVTTLQDSIRKVT
EENKELANELRKPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSNAT
VPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQTRT
CHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQLNGKPCEGEARETK
ACRKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPAPQFGGKDCVGDVTENQICN
KQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGTCPPGYSGNGIQCKDVDECKEVPDACFNH
NGEHRCRNTDPGYNCLPCPPRYTGTQPFGRGVEHAMANKQVCKPRNPCTDGTHDCNKNAK
CNYLGHYSDPMYLCECKPGYAGNGIICGEDTDLDGWPNEDLXXXXXXXXXXXXDNCPNLP
NSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDICPXXXX
XXXXXXXXXXXXXXXXXXXXXXXILNERDNCQYVYNVDQDTDMDGVGDQCDNCPLEHNPD
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMADSGPIYDKTY
AGGRLGLFVFSQEMVFFSDMKYECRDS
Download sequence
Identical sequences ENSOPRP00000013079 ENSOPRP00000013079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]