SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013224 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013224
Domain Number 1 Region: 205-349
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-33
Family Nuclear receptor ligand-binding domain 0.00000251
Further Details:      
 
Domain Number 2 Region: 136-217
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.95e-31
Family Nuclear receptor 0.0000105
Further Details:      
 
Domain Number 3 Region: 414-457
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000000000302
Family Nuclear receptor ligand-binding domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013224   Gene: ENSOPRG00000014490   Transcript: ENSOPRT00000014486
Sequence length 463
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2625:321315:387279:-1 gene:ENSOPRG00000014490 transcript:ENSOPRT00000014486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGNYSHFMKFPTGFGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGIPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDVNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGGIELLIASFSHRSVSVQDGVLLATGLHVHRSSAHSAGVGSIFDXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Download sequence
Identical sequences ENSOPRP00000013224 ENSOPRP00000013224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]