SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013255 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013255
Domain Number 1 Region: 624-665
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000582
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Domain Number 2 Region: 713-753
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000735
Family Ovomucoid domain III-like 0.022
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000013255
Domain Number - Region: 750-781
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0194
Family Ovomucoid domain III-like 0.018
Further Details:      
 
Domain Number - Region: 589-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Cripto EGF-like domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013255   Gene: ENSOPRG00000014513   Transcript: ENSOPRT00000014522
Sequence length 971
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2314:15535:97060:1 gene:ENSOPRG00000014513 transcript:ENSOPRT00000014522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAPGSLRGGLLLLLAVAGVAGVAGGLAPGSPXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXVEIWSCMNSSVPGVFKKSDGWVGLGCCELAIALECRQACKQA
SSKNDISKICRKEYENALFSCISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQI
KAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQTACKRILMSKKTEM
EIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPPPSTGLDGAKLHCCSKANTST
CRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVSMLTCLADVREPCQLGCRNLTYCTNFN
NRPTELFRSCNAQSDQGAMNDMKLWEKGSIKMPFISIPVLDIKKCQPEMWKAIACSLQIK
PCHSKSRGNIICXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP
STLGNIVEEVTHPCNPNPCPANELCEVNRKGCPSGDPCLPYSCVQGCKLGEASDFIVRQG
TLIQVPSSAGEVGCYKICSCGQGGLLENCMETHCVDLQKSCIVEGKRKSHGTSFKINCNV
CSCFAGSLVCFERLCLSEHSAEDDRRSFTGLPCNCADQFVPVCGQNGRTYPSACIARCVK
LQDHQFEFGSCISKNPCHPNPCQRTQRCVPKPQVCLTTFAKFGCSQYECVPRQLACDQVR
DPVCDTDHVEHNNLCTLYQRGKSLSYQGPCQPFCRTSEPVCGHNETYSSVCAAYSERVEV
DYYGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXACCPLCAGMLRVLYDQEK
LDTIAKVTNKKPVTVLDILEKIRTHVSVPQCDVFGYLSIESELVILITPVDHLPKALQIE
ACNREAEKIESLINSDSPTLAAHVPLSALIISQVQISSSLPAASTQASPPCLCLLLLLSL
GLALHLLWTQN
Download sequence
Identical sequences ENSOPRP00000013255 ENSOPRP00000013255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]