SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013301 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013301
Domain Number 1 Region: 8-244
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.58e-82
Family Proteasome subunits 0.000000000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013301   Gene: ENSOPRG00000014580   Transcript: ENSOPRT00000014572
Sequence length 245
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_780:325338:347311:1 gene:ENSOPRG00000014580 transcript:ENSOPRT00000014572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVTAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVA
LAERD
Download sequence
Identical sequences ENSOPRP00000013301 ENSOPRP00000013301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]