SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013315 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013315
Domain Number 1 Region: 8-131,237-295
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.77e-26
Family FAD-linked reductases, N-terminal domain 0.00082
Further Details:      
 
Domain Number 2 Region: 182-237
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000322
Family D-aminoacid oxidase-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013315   Gene: ENSOPRG00000014594   Transcript: ENSOPRT00000014586
Sequence length 302
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_439:275344:278717:1 gene:ENSOPRG00000014594 transcript:ENSOPRT00000014586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTGLLLLGMAGNPELKATEATLSSHGLDHQYLSSEELKQHFPNIRVTKGEVGLLDKSGGV
LYADKALRALQDVLCQLGGIVCDGEKVLDIKPGLPVTVTTTSRSHQAKNLIITAGPWTNR
LLRPLGIELPLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XICYHHGDAVDPEERDCPTAVTDIQDVQILCHFVRAHLPGLKPEPDILERCMYTNTPDMH
FVLDRHPKYDNIVIGAGFSGHGFKLSPVVGKILCELSMKLTPSYDLTPFRISRFPGLGKA
HL
Download sequence
Identical sequences ENSOPRP00000013315 ENSOPRP00000013315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]