SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013334 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013334
Domain Number 1 Region: 31-325
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.1e-90
Family Nuclear receptor ligand-binding domain 0.0000000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013334   Gene: ENSOPRG00000014613   Transcript: ENSOPRT00000014607
Sequence length 330
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2457:16537:21024:-1 gene:ENSOPRG00000014613 transcript:ENSOPRT00000014607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILTDEEVQRKREMILKRKEEEALRDSLRPRLSEEQQHIIAVLLDAHHKTYDPTYADFSQF
RPPVREAACVNSHLWRPAPSCSGDASCLGSDHLSTFSDLIEPSGFSSLDLGQEDSDDPSM
TLDLSHLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQ
SFTMDDMSWDCGSQDYKYNINDVTKAGHSLELIEPLVKFQVGLKKLNLHEEEHVLLMAIC
IVSPDRPGVQDTQLVEAIQDRLSTTLQTYIRCHHPPPGSHLLYAKMIQKLADLRSLNEEH
SKQYRCLSFQPGSSIKLTPLVLEVFGNELS
Download sequence
Identical sequences ENSOPRP00000013334 ENSOPRP00000013334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]