SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013417 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013417
Domain Number 1 Region: 68-363,530-566
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-33
Family FAD-linked reductases, N-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013417   Gene: ENSOPRG00000014695   Transcript: ENSOPRT00000014697
Sequence length 604
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3497:222780:232850:-1 gene:ENSOPRG00000014695 transcript:ENSOPRT00000014697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLVLLLPAALLLLVLRKVYLGLFASSSPNPFSEDVKRPPAPLVTDKEARKKVLRQXXXX
XXXXXXXDAVVIGSSIGVAAAAILAKGKRVLVLEQHAKAGCCHFGKNGLEFDTGIHYVGR
MQEGSSDRFILDQITEGQLDWAALSSPFDIMVLEGPDGRKQFPMCSGEEPYIQGLKEKFP
GEEAAIDKYMKLVKVVSRGAVHAVLLKFLPLPLAQLLSKCGPLMRLSPFLRASTQSLAEV
LRQLGASPQLQAVLSYIFPTYGVTPSHAAFAMHAVLVNHYIKGSFYPRGGSSEIAFHIIP
VIQRAGGAVLTKASVHRVLLDSAGRACGVSVRKGSELVNIYCPIVISSAGLFNTYEHLLP
ETARCLPGVKQQLGLVRPGLAMFSIFICLRGTKEELGLQSTNYYVYFDTDMDKAMERYIS
MPKDKAAEHIPLLFIAFPSAKDPTWEDRFPGRSTMNILVPTAFEWFEEWQEEPKGKRGND
YETFKGTFVEACMAVVMRLFPHLEGKVDSVTGGSPLTSQFYLAAPRGACYGADHDLGRLH
PQVMASLRAQTPIPNLYLTGQDIFTCGLMGALHGALLCSSTILKRNLYADLTALGSRIQA
KKKT
Download sequence
Identical sequences ENSOPRP00000013417 ENSOPRP00000013417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]