SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013455 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013455
Domain Number 1 Region: 411-813
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.7e-109
Family Phosphofructokinase 0.00000787
Further Details:      
 
Domain Number 2 Region: 86-374
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.62e-88
Family Phosphofructokinase 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013455   Gene: ENSOPRG00000014719   Transcript: ENSOPRT00000014738
Sequence length 846
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2457:254359:311232:1 gene:ENSOPRG00000014719 transcript:ENSOPRT00000014738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKEEFHLKFFMCVIRSQQVVRTPPSTAGEASTSSRLLPSPSSKPEASPGLDTEDDPDSQ
EGTSPLPTEWIMTHEEHHAAKTLGVGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVF
FVHEGYQGLVDGGDHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRG
ITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITAEEATKSSYLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPEDDWEDHLCRRLSETRNRGSRLNIIIVAEGAIDRHGKPITSEGVKDLVVKRLGY
DTRVTVGHVQRGTPSFDALXXXXXXXXXXXXXXXXXXTPACVVSLSGNQAVLPLMECVQV
TKDVTKAMDEKKFDEAMKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAG
MNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLP
RKSFEQISANITKFNIQGLIIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVP
GSDFSIGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAY
IFEEPFTIRDLQANVDHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDS
RKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMR
KRALVFQPVTELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKR
SGEAAV
Download sequence
Identical sequences ENSOPRP00000013455 ENSOPRP00000013455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]