SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013658 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013658
Domain Number 1 Region: 1741-1902,1936-1986
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.47e-40
Family Ankyrin repeat 0.00000156
Further Details:      
 
Domain Number 2 Region: 429-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000162
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 3 Region: 772-886
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000022
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 4 Region: 350-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000493
Family EGF-type module 0.00072
Further Details:      
 
Domain Number 5 Region: 390-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000781
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 6 Region: 234-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000383
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 7 Region: 196-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 882-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000149
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 9 Region: 117-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000493
Family EGF-type module 0.0021
Further Details:      
 
Domain Number 10 Region: 1296-1332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000062
Family EGF-type module 0.018
Further Details:      
 
Domain Number 11 Region: 159-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000224
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 12 Region: 885-999
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000549
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 13 Region: 79-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000101
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 693-730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 651-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000383
Family EGF-type module 0.01
Further Details:      
 
Domain Number 16 Region: 612-647
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000485
Family EGF-type module 0.01
Further Details:      
 
Domain Number 17 Region: 1347-1379
Classification Level Classification E-value
Superfamily Notch domain 0.00000051
Family Notch domain 0.0017
Further Details:      
 
Domain Number 18 Region: 313-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000587
Family EGF-type module 0.017
Further Details:      
 
Domain Number 19 Region: 1430-1460
Classification Level Classification E-value
Superfamily Notch domain 0.000000693
Family Notch domain 0.0044
Further Details:      
 
Domain Number 20 Region: 732-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family EGF-type module 0.019
Further Details:      
 
Domain Number 21 Region: 467-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000305
Family EGF-type module 0.011
Further Details:      
 
Domain Number 22 Region: 1005-1046
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000257
Family EGF-type module 0.036
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000013658
Domain Number - Region: 1042-1067
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000799
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 1387-1413
Classification Level Classification E-value
Superfamily Notch domain 0.00994
Family Notch domain 0.0081
Further Details:      
 
Domain Number - Region: 1241-1283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0859
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013658   Gene: ENSOPRG00000014896   Transcript: ENSOPRT00000014959
Sequence length 2145
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_417:3:25447:-1 gene:ENSOPRG00000014896 transcript:ENSOPRT00000014959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPCLDGGPCANGGLCTQLPSGEPACLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXPDCSLDPCLSSPCAHGGRCSVGSDGRFVCSCPPGYQGRSCRSDMDE
CRLGGPCRHGGTCLNTPGSFRCQCPSGYTGPLCASPAAAPCAPSPCRNGGTCRQSGDATY
DCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQL
QPNACHNGGTCFNTLGGHSCVCVNGWTGESCSRNIDDCATAVCFHGAXXXXXXXXXXXXX
XXXXXXLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGAN
PCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAG
FTGIYCEVDIDECQSSPCVNGGSCRDRVNGFSCTCPSGFSGATCQLDVDECASTPCRNGA
KCVDQPDGYECHCAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXPLCVAINECASSPCGEGGSCVDAENGFRCLCPPGSLPPLCLPLSHPCAH
EPCGHGVCHDAPGGFRCVCEPGWSGPRCSQSLTRDICESQPCRAGGTCTSDGSGFHCTCP
PGVQGRQCELPSPCTPNPCEHGGRCGSAGHMPLCSCPPGWQGPRCQQDVDECAGPSACGP
HGTCSNLAGSFSCTCHRGYTGPSCDQDINDCDPNPCLNGGSCLDGPDSFSCSCLPGFAGP
RCARDVDECLSSPCGPGTCTDHVASFTCSCPPGYGGLHCEEDLPNCSPSSCFNGGTCVDG
VNSFSCLCHPGYTGAHCQHEADPCLSRPCLHGGVCSAAHPGFRCTCQEGFTGTQCQTLVD
WCSRGLCQNGARCVQTGAYCLCPPGWSGRFCNIRSLPCKEAAAQMGVQVEHVCQAGGQCV
SEDNSHFCLCPEGRTGSHCEQEVDPCVAQPCRHGATCRGYMGGYVCEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFWGPHCEQIAGSCRELQCPGRV
PCQQTVRGPRCACPPGLSAPSCRGSRWSPPGIANASCTASPCLHGGTCHPAALAPFFHCV
CAPGWAGPRCEAPQKAAPLEEQLEEPRCPRAACLAKRGDHRCDRECNSPGCGWDGGDCSL
SVGDPWRQCEALQCWRLFNNSRCDPACSSPACYDNXXXXXXXXXXXXXPVYEKYCSDHFA
DGRCDQGCNTEECCWDGLDCAGEVPALLARCVLLLTVLLPPEELLRSGTDFLQRLSAILH
TSLRFRLDAHGQAMVFPYHRPTGGAAAESRARRELAPEVIGXXXXXXXXXXXXXXXXXXX
XXXXXXXXXADYLGALSAVERLDFPLPLRDVRGEPLDPPEPSWPLLPLLAAGAVFLLLIL
VLGVMVARRKREHSILWFPEGFSLHKDVASGHKGRREPVGQDALGMKNMAKGEGLMSQVT
ADWLDSECPEAKRLKVGDPSVEAEEAVDCRQCTQHPLVAADIRVAPAMALTTPQGDADAD
GMDVNVRGPDGFTPLMLASFCGGTLEPVPTEEDEGEDTSANIISDLICQGAQLGARTDRT
GETALHLAARYARADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTD
LDARMADGSTALILAARLAVEGMVEELIASHADVNAVDELXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXEETPLFLAAREGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQ
DIVRLLDQPSGPRSPPGPHGLGPLLRAGLKGPQTGPKKSRSPPDKARLGAQGPRGKKLTL
ACPGGALAESSVTLSPVDSLDSPRPFGGPPASPGAFPLDVPYAAATVSLAQLGGPGRLPL
GRQPAGCVLSLGLLNPVAVPLDWARLPPPPPGPSFLPLAPTPQVL
Download sequence
Identical sequences ENSOPRP00000013658 ENSOPRP00000013658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]