SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013742 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013742
Domain Number 1 Region: 159-271
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-35
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 2 Region: 37-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-35
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 316-366
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000377
Family Netrin-like domain (NTR/C345C module) 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013742   Gene: ENSOPRG00000015052   Transcript: ENSOPRT00000015048
Sequence length 366
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2801:193152:197183:1 gene:ENSOPRG00000015052 transcript:ENSOPRT00000015048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAATVSFLGPLLTAWALLPLTRGQTPNYTRPVFLCGGDVTGDSGYVASEGFPNLYPPN
KECIWTITVPEGQTVSLSFRVFDLELHPSCRYDALEIFAGAGTSGQRLGRFCGTFRPAPV
IAPGNQVTLRMTADEGTGGRGFLLWYSGRATSGTEHQVCGGRMEKAQGTLTTPNWPESDY
PPGVSCSWHIIAPPDQVIALTFGKFDLEPDTYCRYDSVSIFNGAVSDDAKRLGKFCGDMT
PGPIFSEGNELLVQFVSDLSVTADGFSAFYKIQSRGITRAGPGPGPKTGTGPKVKPPPKP
RVQPTEKTKATATGPGAPCPKQCQRTGTLQGNFCTSSLVVTGTVKSIVRGPGEGLTVTVS
LMNVYK
Download sequence
Identical sequences ENSOPRP00000013742 ENSOPRP00000013742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]