SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013763 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013763
Domain Number 1 Region: 147-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.91e-94
Family Transglutaminase core 0.0000000378
Further Details:      
 
Domain Number 2 Region: 3-145
Classification Level Classification E-value
Superfamily E set domains 1.4e-40
Family Transglutaminase N-terminal domain 0.00019
Further Details:      
 
Domain Number 3 Region: 499-611
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.49e-28
Family Transglutaminase, two C-terminal domains 0.00025
Further Details:      
 
Domain Number 4 Region: 613-711
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.28e-26
Family Transglutaminase, two C-terminal domains 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013763   Gene: ENSOPRG00000015055   Transcript: ENSOPRT00000015071
Sequence length 714
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_846:112939:141081:-1 gene:ENSOPRG00000015055 transcript:ENSOPRT00000015071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGLELALTDFQSSRNNVRHHTEEIAVDRLLVRRGQAFAITLYFRNRGFQPGLDNIIFV
AETGPLPDVAKGTRAVFSLAGRGGPSPWIASLENNRATSLEVSLCAPPVAAVGRYLLKVH
IDPVQGSATAYQLGEFILLFNPWCPGDAVYLDSEPQRQEYVVNDYGFIYQGNKNWIRPCP
WNYGQFEDNIVDICLELLDKSLNFHVDPSTDCALRGSPVYISRVVCAMINSNDDSGVLNG
NWSENYSDGVNPAEWTGSVAILKQWHAMGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLVIDEYYDSTGRILDNKKKDSIXXXXXXXECWMAQHPSCYGWLLEATHQ
ETSNVLYCCGPASVSPFKEGEVDLKYDTLFAFSMNADCVSWLSYGGKEQRLHGTTNAVGG
SFSTKGVRSDERDDVTESYKYEEGSPQERQVFLKALQKLQARRVPDLREAAAPLPTPMPL
SRNSPRSLDTSSLPSSNAAQVSLKFKLVDPPNMGQDINLVLLAINMSHQFKDLKVNLSAQ
SLLHDGSPLAPFWQDTAFITLSPEEAKTYPCTIPYSQYSQYLSTDKLIRISALSEEKNSP
EKILVNKIITLAYPSIMINVLGAAIVNQSLSIQVIFSNPLSEQAANCVLTVEGSGLFKKQ
QRVLIGVLKPQHRASITLKTVPFKSGQRQIQANLKSDKFKDIKGYRNVYVDCGL
Download sequence
Identical sequences ENSOPRP00000013763 ENSOPRP00000013763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]