SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013782 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013782
Domain Number 1 Region: 148-465
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.24e-121
Family Transglutaminase core 0.00000000978
Further Details:      
 
Domain Number 2 Region: 5-146
Classification Level Classification E-value
Superfamily E set domains 7e-45
Family Transglutaminase N-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 608-705
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.09e-24
Family Transglutaminase, two C-terminal domains 0.00063
Further Details:      
 
Domain Number 4 Region: 488-606
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.59e-23
Family Transglutaminase, two C-terminal domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013782   Gene: ENSOPRG00000015092   Transcript: ENSOPRT00000015091
Sequence length 706
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_846:150506:172559:-1 gene:ENSOPRG00000015092 transcript:ENSOPRT00000015091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQVAALELTSVDLQSSQNNKEHHTQEMGLGRLIVRRGQLFHIRLGFHRPFQPHSDHVTF
VVETGPEPTELLGTRATLPLTQARGGKGWSASDFTVDSNFLQVSLFSPANAVIGHYTLKI
EMAQSQGHSLVVPLGTFTLLFNPWSAEDDVYLPSETLLQEYIMRDYGFVYKGHERSVSSW
PWNYGQFEEGILDICFEILDKSLHFLRNPSQDCSQRSDVVYVCRVVSAMINSNDDSGVLQ
GNWGEDYSQGVSPLEWNGSVAILRQWSARAGQPVKYGQCWVFASVMCTVMRCLGVPTRVV
SNFRSAHNVDGNLTIDTYYDANAEMLSTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVL
DPTPQQTSSGLFCCGPASVKAIREGEVHLAYDTPFVYAEVNADEVVWLCRAGQPQEVLAH
DSYSIGKEISTKMAGSDQRQVITGSYKYPEGSPEERAVFMKASRKMLGPSRASSPLLDLL
GSRGLEAQPAQLQLLLSRTPVWGQDLLLMLHVRRVPNRAHPRGPIGLMVRICAQTLLHRG
GTWGPLWRQTVHLNLDFEQEVWWPLLLPYSSYRNKLTDEKLIRVAGIAEVEETGRSMLVL
KDISLEPPHLSIKASERAEVGKMLRVHITLTNTLTVALNNCMIVLEGSGLLNGQLSEELG
TLAAGHTVQIQLDLYPIKAGPRQLQVLISSNEVKEIKGYKDILVTA
Download sequence
Identical sequences ENSOPRP00000013782 ENSOPRP00000013782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]