SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013867 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013867
Domain Number 1 Region: 176-440
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-86
Family Nuclear receptor ligand-binding domain 0.000000000159
Further Details:      
 
Domain Number 2 Region: 71-153
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.64e-27
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013867   Gene: ENSOPRG00000015187   Transcript: ENSOPRT00000015182
Sequence length 441
Comment pep:known_by_projection scaffold:pika:scaffold_8900:57811:67916:1 gene:ENSOPRG00000015187 transcript:ENSOPRT00000015182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPPEETPEVREKEEKEEVAETEGAQELSGGPEQVLPSSSYADLSQSSSPPVLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRSCKIQKK
NRNKCQHCRFKKCLALGMSHNAIRFGRMPEAEKRKLVAGLTAVEGHQHSPQVADLKAFSK
HIYNAYLKNFNMTKKKARGILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNALPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPNFSNLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPQVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
Download sequence
Identical sequences ENSOPRP00000013867 ENSOPRP00000013867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]