SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013888 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013888
Domain Number 1 Region: 731-946
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-102
Family Thrombospondin C-terminal domain 0.000000152
Further Details:      
 
Domain Number 2 Region: 604-729
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.83e-34
Family TSP type-3 repeat 0.00000509
Further Details:      
 
Domain Number 3 Region: 220-265
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 3.14e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00096
Further Details:      
 
Domain Number 4 Region: 51-157
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000653
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 5 Region: 293-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000596
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000013888
Domain Number - Region: 579-606
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000929
Family TSP type-3 repeat 0.0027
Further Details:      
 
Domain Number - Region: 332-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00113
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013888   Gene: ENSOPRG00000015200   Transcript: ENSOPRT00000015209
Sequence length 963
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3021:378501:409726:1 gene:ENSOPRG00000015200 transcript:ENSOPRT00000015209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAALHPLFLSLLHLALPRWLGAGAQATPQVFDLVPFLSGERLPPGALQQLLADPALPD
LYILATFRLQTKSATTVLGLYSASDGSRYFEFTVMGRLNRAILRYLKSDGKIHQVVFNNL
QLADGQRHRVLLRLTNLQRGPGSVDLYMDCIQVDSAHSLPRAFAGLAQSPKSLELRTFQG
KAQGLFEELKLVVQGSLFQAASLQDCFLQQSEPLATTNTGDFNRQFLGQMAQLNQLLGEV
KDLLRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVPPAPPAPPTRSPRRCDSNPCFR
GVRCTNTRDGFQCGPCPEGYTGNGITCSDVDECKYRPCYPGVHCVNLAPGFRCDACPVGF
SGPPVQGVGIAFAKSTKQVCTDIDECANGACVLNSMCTNTLXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGVGWAGDGYVCGKDVDIDSYPDEELPC
SARNCRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRNILDNCPKVPNRDQRDKDSDG
VGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKD
GIGDECDDDDDNDGIPDSVPPGPDNCRLVPNPGQEDSNSDGVGDICESDFDQDQVIDRID
VCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFN
GVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLK
AVKSQTGPGEHLRNSLWHTGDTSDQVLLLWKYSRNVGWKDKVSYRWFLQHRPQVCYIWVR
FYEGSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDQEFQTQNFDR
LDN
Download sequence
Identical sequences ENSOPRP00000013888 ENSOPRP00000013888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]