SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014040 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014040
Domain Number 1 Region: 107-246
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-32
Family C-type lectin domain 0.0000696
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014040   Gene: ENSOPRG00000015380   Transcript: ENSOPRT00000015371
Sequence length 248
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5227:78813:89944:-1 gene:ENSOPRG00000015380 transcript:ENSOPRT00000015371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECHSSLENVDEDGYTQLNFHSRVTNRTHVLPQKGTQRTAPPSWRLIAVILGVLCLVILV
VAVVLAALTFQRSNSGSQPLENDNFPSRNKENHNQPTKSSLEEKVAPTKALKTTGFFPSS
CPPNWIMHETSCYLFSTSLDSWNESRRRCSQLDSNLLKMDSSKELGFINREVSSQAAHSF
WIGLSRSQSEEPWLWEDGSMFSPHIFEVRSTATQENSSHNCAWIHMSVVYDQLCHVPSYS
ICEKKLSL
Download sequence
Identical sequences ENSOPRP00000014040 ENSOPRP00000014040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]