SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014113 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014113
Domain Number 1 Region: 28-161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-18
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 294-415
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.41e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 160-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000733
Family EGF-type module 0.018
Further Details:      
 
Domain Number 4 Region: 635-685
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000534
Family Growth factor receptor domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000014113
Domain Number - Region: 888-927
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00718
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014113   Gene: ENSOPRG00000015429   Transcript: ENSOPRT00000015450
Sequence length 1004
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1732:150744:185235:1 gene:ENSOPRG00000015429 transcript:ENSOPRT00000015450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGLLPGLCLLVLLVHVRAAQHSKVAQDVDECVEGTDNCHIDAICQNTPRSYKCICKSG
YTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGN
GGCQQSCVNMMGSYECHCREGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGI
ACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTEQGPRCGCXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDECRLN
NGGCDHICRNTVGSFECSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCH
RGYLLYGVTHCGDVDECSINRGGCRFGCINTPGSYQCTCPAGHGRLHWNGKDCTEPVKCQ
GNPGASKAMLSCNRSGKKDTCALTCPSRARFLPESENGFTVSCGTPSPRAAPARAGHTGN
STSSNHCHXXXXXXXXXXXXXXXXXXXCRLHRGKTRAANARSGGAPCSDCQVTFIHLKCD
SSSRKGKGRRARTPPGKEVTRLTLELEAEIRAEETTAACGLPCLRQRMERRLKGSKMLRK
SINQDRFLLRLAGLDYELAHKPGPAPGERAEPMEACRPGQHRSGTKCVSCPQGTYYHGQT
EQCVPCPAGTFQEREGQLSCDLCPGSDAQGPLGATNVTTCAXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTYETCQTYERPIAFTA
RSRKLWINFKTSEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLI
KAFFEVLAHPQNYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences ENSOPRP00000014113 ENSOPRP00000014113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]